PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 395aa    MW: 45485.7 Da    PI: 6.9691
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00106genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.4e-081439126
                     TSSS-HHHHHHHHHHHHHTTTT-HHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWkt 26
                     rg W++eEde+l+++++ +G g+W+t
       AA26G00106 14 RGLWSPEEDEKLINYINTYGHGCWST 39
                     788*********************98 PP

2Myb_DNA-binding48.22.5e-155597145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
       AA26G00106 55 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 97
                     899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.68E-231196IPR009057Homeodomain-like
SMARTSM007178.4E-51351IPR001005SANT/Myb domain
PfamPF002496.9E-61448IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-141556IPR009057Homeodomain-like
PROSITE profilePS5129425.20950104IPR017930Myb domain
SMARTSM007171.5E-1554102IPR001005SANT/Myb domain
PfamPF002493.8E-145598IPR001005SANT/Myb domain
CDDcd001676.36E-115797No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2557104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIN TYGHGCWSTS CRLRWINYLR PDLKRGSFSP  60
QEAALIIELH SILGNRWAQI AKHLPGRTDN EVKNFWNSSI KKKLMSHHHH LHHGHHHHHH  120
HHNHGHISLL TNLPYHNGFN LINREDNEGS RFFPNLITNT NPNFLTTPQN HIDHHHHNHH  180
NHHNHHNHLS LLSPNVMMTN PLMFSRDQSY NILSTTQIIN NHQQQQSLIS SSNSSHDNNN  240
NNNNDPQWSL PDFPATISTF QDYDDHNNNK LNIVEDQVVY VTSYNDNNSH HQHHHHQHDH  300
DDHESNNELV ATKLLLCGEE VLEGKVLSLS SPNSQDHTNS LLPTYNNGLH QVESYNMNPS  360
MIIIPSSSSS SSQISCGEYV ITPANPSPTQ STWDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141047108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759971e-61AF175997.1 Arabidopsis thaliana putative transcription factor (MYB26) mRNA, complete cds.
GenBankAY5195881e-61AY519588.1 Arabidopsis thaliana MYB transcription factor (At3g13890) mRNA, complete cds.
GenBankDQ4466611e-61DQ446661.1 Arabidopsis thaliana clone pENTR221-At3g13890 myb family transcription factor (At3g13890) mRNA, complete cds.
GenBankDQ6530831e-61DQ653083.1 Arabidopsis thaliana clone 0000019124_0000013170 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299589.11e-113hypothetical protein CARUB_v10015767mg
SwissprotQ9SPG31e-108MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A087H9E61e-120A0A087H9E6_ARAAL; Uncharacterized protein
STRINGAT3G13890.11e-105(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128031930
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.25e-99myb domain protein 26